Monthly Archives: October 2025

Name : RAF1 (Y340D/Y341D) (Human) Recombinant Protein Biological Activity : Human RAF1 (NM_002880.2, 306 a.a. – 648 a.a.) Y340D and Y341D mutant partial protein expressed in Sf9 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Result of activity analysis Protein Accession No. : NM_002880.2 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=5894 Amino Acid Sequence : Molecular Weight : …

Continue reading “RAF1 (Y340D/Y341D) (Human) Recombinant Protein”

Product Name : Human NGAL/Lipocalin-2 Protein 3779express system : HEK293Product tag : C-hFcPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Acute kidney injury (AKI) is one of the most common complications of various serious conditions, and early diagnosis is therefore critical for the treatment of AKI. Recent evidence demonstrates that …

Continue reading “Human NGAL/Lipocalin-2 Protein 3779”

Name : Cynomolgus CD20 / MS4A1 Full Length Protein, His Tag (Detergent) Background : B-lymphocyte antigen CD20 is also known as B-lymphocyte surface antigen B1, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1 and MS4A1, is an activated-glycosylated phosphoprotein expressed on the surface of all B-cells beginning at the pro-B phase (CD45R+, CD117+) …

Continue reading “Cynomolgus CD20 / MS4A1 Full Length Protein, His Tag (Detergent)”

Name : Il31 (Mouse) Recombinant Protein Biological Activity : Mouse Il31 (Q6EAL8) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Result of activity analysis Protein Accession No. : Q6EAL8 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=76399 Amino Acid Sequence : MTCSLSFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQLPCFSLDREALTNISVIIAHLEKVKVLSENTVDTSWVIRWLTNISCFNPLNLNISVPGNTDESYDCKVFVLTVLKQFSNCMAELQAKDNTTC Molecular Weight : 15.7 Storage and Stability : Store at -20°C on …

Continue reading “Il31 (Mouse) Recombinant Protein”

Product Name : Human KIR2DL5 Protein 3409express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGEBackground: A recently developed anti-KIR2DL5 (CD158f) antibody has demonstrated KIR2DL5 expression on the surface of NK and T lymphocytes, making it the last functional KIR identified in the human genome. KIR2DL5 belongs to an ancestral lineage …

Continue reading “Human KIR2DL5 Protein 3409”

Name : Human FOLR1 Protein, His Tag (MALS verified) Background : Folate Receptor 1 (FOLR1) is also known as Folate receptor alpha, Folate Binding Protein (FBP), FOLR, and is a member of the folate receptor (FOLR) family. Members of this gene family have a high affinity for folic acid and for several reduced folic acid …

Continue reading “Human FOLR1 Protein, His Tag (MALS verified)”

Name : ALB (Human) Recombinant Protein (P01) Biological Activity : Human ALB full-length ORF ( AAH34023, 19 a.a. – 609 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : AAH34023 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=213 …

Continue reading “ALB (Human) Recombinant Protein (P01)”

Product Name : Human HLA-A*02:01&B2M&MAGE-A4 (GVYDGREHTV) Tetramer Protein 3423express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Melanoma-associated antigen 4 is a protein that in humans is encoded by the MAGEA4 gene.The MAGE- A4 antigen is among the most commonly expressed cancer testis antigens. The …

Continue reading “Human HLA-A*02:01&B2M&MAGE-A4 (GVYDGREHTV) Tetramer Protein 3423”

Name : Human LIF R / CD118 Protein, Fc Tag Background : Leukemia inhibitory factor receptor is also known as LIFR; CD118; FLJ98106; FLJ99923; LIF-R; SJS2; STWS; SWS, is the receptor for leukemia inhibitory factor (LIF). The leukemia inhibitory factor is a polyfunctional cytokine that affects the differentiation, survival, and proliferation of a wide variety …

Continue reading “Human LIF R / CD118 Protein, Fc Tag”

Name : C4b (Mouse) Recombinant Protein Biological Activity : Mouse C4b partial ORF (NP_033910.2, 20 a.a. – 119 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_033910.2 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=12268 Amino Acid Sequence : KPRLLLFSPSVVNLGTPLSVGVQLLDAPPGQEVKGSVFLRNPKGGSCSPKKDFKLSSGDDFVLLSLEVPLEDVRSCGLFDLRRAPHIQLVAQSPWLRNTA …

Continue reading “C4b (Mouse) Recombinant Protein”