| Product Name |
Alpha Synuclein Protein |
| Description |
Human Recombinant Alpha Synuclein Protein Monomer (Control)
|
| Applications |
,
WB
,
SDS-PAGE
,
In vivo assay
,
In vitro assay
|
| Concentration |
Lot/batch specific. See included datasheet. |
| Conjugates |
No tag
| APC (Allophycocyanin) |
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa
APC Datasheet |
 |
Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5 |
| ATTO 390 |
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet |
 |
Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm |
| ATTO 488 |
Overview:
- High fluorescence yield
- High photostability
- Very hydrophilic
- Excellent solubility in water
- Very little aggregation
- New dye with net charge of -1
- Molar Mass: 804 g/mol
ATTO 488 Datasheet |
 |
Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC |
| ATTO 565 |
Overview:
- High fluorescence yield
- High thermal and photostability
- Good solubility in polar solvents
- Excellent solubility in water
- Very little aggregation
- Rhodamine dye derivative
- Molar Mass: 611 g/mol
ATTO 565 Datasheet |
 |
Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC |
| ATTO 594 |
Overview:
- High fluorescence yield
- High photostability
- Very hydrophilic
- Excellent solubility in water
- Very little aggregation
- New dye with net charge of -1
- Molar Mass: 1137 g/mol
ATTO 594 Datasheet |
 |
Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red® |
| ATTO 633 |
Overview:
- High fluorescence yield
- High thermal and photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Stable at pH 4 – 11
- Cationic dye, perchlorate salt
- Molar Mass: 652.2 g/mol
ATTO 633 Datasheet |
 |
Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5 |
| ATTO 655 |
Overview:
- High fluorescence yield
- High thermal and photostability
- Excellent ozone resistance
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 634 g/mol
ATTO 655 Datasheet |
 |
Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5 |
| ATTO 680 |
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 631 g/mol
ATTO 680 Datasheet |
 |
Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5 |
| ATTO 700 |
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol
ATTO 700 Datasheet |
 |
Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5 |
| FITC (Fluorescein) |
Overview:
- Excellent fluorescence quantum yield
- High rate of photobleaching
- Good solubility in water
- Broad emission spectrum
- pH dependent spectra
- Molecular formula: C20H12O5
- Molar mass: 332.3 g/mol
FITC-Fluorescent-conjugate |
 |
Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC |
| PE/ATTO 594 |
| PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. |
Overview:
- High fluorescence yield
- High photostability
- Very hydrophilic
- Excellent solubility in water
- Very little aggregation
PE/ATTO 594 Datasheet |
 |
Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm |
| PerCP |
Overview:
- Peridinin-Chlorophyll-Protein Complex
- Small phycobiliprotein
- Isolated from red algae
- Large stokes shift (195 nm)
- Molecular Weight: 35 kDa
PerCP Datasheet |
 |
Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm |
| R-PE (R-Phycoerythrin) |
Overview:
- Broad excitation spectrum
- High quantum yield
- Photostable
- Member of the phycobiliprotein family
- Isolated from red algae
- Excellent solubility in water
- Molecular Weight: 250 kDa
R-PE Datasheet |
 |
Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
AP Datasheet
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
HRP Datasheet
Biotin
Properties:
- Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity
- Molar mass: 244.31 g/mol
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin Datasheet
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Streptavidin Datasheet
|
| Nature |
Recombinant |
| Species |
Human |
| Expression System |
E. coli |
| Amino Acid Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Purity |
92% |
| Protein Length |
Full Length |
| Alternative Names |
Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkison disease familial 1 Protein |
| Research Areas |
Alzheimer_s Disease, Neurodegeneration, Neuroscience, Parkinson_s Disease |
| Cellular Localization |
Cytoplasm, Membrane, Nucleus |
| Accession Number |
NP_000336.1 |
| Gene ID |
6622 |
| Swiss Prot |
P37840 |
| Scientific Background |
Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4).
SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson’s disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). |
| References |
1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).
2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.
3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.
4. Kokhan V.S., Afanasyeva M.A., Van’kin G. (2012) Behav. Brain. Res. 231(1): 226-230.
5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.
6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. |