Name :
EGF (Human) Recombinant Protein
Biological Activity :
Human EGF recombinant protein with His tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1950
Amino Acid Sequence :
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRLE
Molecular Weight :
6
Storage and Stability :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ni-NTA chromatography
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
Lyophilized from PBS, pH 8.0.
Applications :
Functional Study， The ED50 for this effect is 0.05-0.12 ng/mL, measured by the induction of 3T3 cells proliferation. SDS-PAGE，
Gene Name :
EGF
Gene Alias :
HOMG4, URG
Gene Description :
epidermal growth factor (beta-urogastrone)
Gene Summary :
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq
Other Designations :
urogastrone
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Flt-3 medchemexpress
CD19 Recombinant Proteins
Popular categories:
CD82
IFN-gamma R1