Name :
Gdf15 (Mouse) Recombinant Protein

Biological Activity :
Mouse Gdf15 (NP_035949.2, 189 a.a. – 303 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.

Tag :

Protein Accession No. :
Q9Z0J7

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23886

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Weight :
14.9

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of Gdf15 (Mouse) Recombinant Protein

Storage Buffer :
In 20mM Tris-HCl buffer, pH8.0 (10% glycerol).

Applications :
SDS-PAGE,

Gene Name :
Gdf15

Gene Alias :
MIC-1, NAG-1, SBF

Gene Description :
growth differentiation factor 15

Gene Summary :

Other Designations :
Growth/differentiation factor 15 precursor (GDF-15)|OTTMUSP00000027988|OTTMUSP00000027989|macrophage inhibiting cytokine-1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-beta ProteinAccession
IL-23 Recombinant Proteins
Popular categories:
Serpin A5
Small Ubiquitin Like Modifier 3