Name :
CDC26 (Human) Recombinant Protein
Biological Activity :
Human CDC26 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
Q8NHZ8
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=246184
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Molecular Weight :
11.9
Storage and Stability :
Store at 4°C for one weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 40% glycerol, 0.1 M NaCl.
Applications :
SDS-PAGE，
Gene Name :
CDC26
Gene Alias :
C9orf17
Gene Description :
cell division cycle 26 homolog (S. cerevisiae)
Gene Summary :
The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq
Other Designations :
CDC26 subunit of anaphase promoting complex|OTTHUMP00000021952
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EDAR Proteinmanufacturer
IL-1 alpha ProteinGene ID
Popular categories:
PTPRK
CEA Cell Adhesion Molecule 7 (CEACAM7)