Name :
CDKN3 (Human) Recombinant Protein
Biological Activity :
Human CDKN3 (Q16667, 1 a.a. – 212 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
Q16667
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1033
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Molecular Weight :
25.9
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.1 M NaCl and 40% glycerol)
Applications :
SDS-PAGE，
Gene Name :
CDKN3
Gene Alias :
CDI1, CIP2, FLJ25787, KAP, KAP1, MGC70625
Gene Description :
cyclin-dependent kinase inhibitor 3
Gene Summary :
The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
CDK2-associated dual specificity phosphatase|Cdk-associated protein phosphatase|cyclin-dependent kinase interacting protein 2|cyclin-dependent kinase interactor 1|kinase-associated phosphatase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF ProteinSource
IL-2 medchemexpress
Popular categories:
IFN-alpha 14
Siglec-8