Product Name :
Recombinant Mouse Cytotoxic T-Lymphocyte Protein 4,CTLA-4,CD152 (C-6His)

Brief Description :

Accession No. :
P09793

Calculated MW :
14.6kDa

Target Sequence :
AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P09793

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
MiTF Antibody Protocol FGF-8b Protein, Human/Mouse web PMID:34994006 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com