Recombinant Hirudin

By Tankyrase- tankyrase March 24, 2026

Product Name :
Recombinant Hirudin

Brief Description :

Accession No. :

Calculated MW :

Target Sequence :
LTVVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Storage :
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.1. 12 months from date of receipt, -20 to -70 ˚C as supplied. 2. 1 month, 2 to 8 ˚C under sterile conditions after reconstitution.3. 3 months, -20 to -70 ˚C under sterile conditions after reconstitution.

Application Details :

Uniprot :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
DDX50 Antibody Biological Activity Phospho-MEK1/2(Ser217/221) Antibody supplier PMID:35220609 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Hirudin

By Tankyrase- tankyrase

You Missed

Recombinant Human LAIR1

PF 04449913

Recombinant Human CCNJ

ADH-1

By Tankyrase- tankyrase

Related Post

You Missed