Recombinant Human Elafin,Trappin-2 (C-6His)

By Tankyrase- tankyrase May 1, 2026

Product Name :
Recombinant Human Elafin,Trappin-2 (C-6His)

Brief Description :

Accession No. :
P19957

Calculated MW :
11kDa

Target Sequence :
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH

Storage :
Store at Please minimize freeze-thaw cycles.

Application Details :

Uniprot :
P19957

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Abciximab In Vivo Veratridine custom synthesis PMID:35187741 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human Elafin,Trappin-2 (C-6His)

By Tankyrase- tankyrase

You Missed

A RADD Approach to Probing AAA+ Protein Function

An Effective Fluorescent Sensor for ClO⁻ in Aqueous Media Based on Thiophene-Cyanostilbene Schiff-Base

G1/S-specific cyclin-D2

STIP1 homology and U box-containing protein 1

By Tankyrase- tankyrase

Related Post

You Missed