Rab5 Protein

Rab5 Protein__Human Recombinant Rab5 Protein EGF817

Product Name	Rab5 Protein
Description	Human Recombinant Rab5 Protein
Applications	, WB , SDS-PAGE
Concentration	Lot/batch specific. See included datasheet.
Conjugates	His tag APC (Allophycocyanin) Overview: High quantum yield Large phycobiliprotein 6 chromophores per molecule Isolated from red algae Molecular Weight: 105 kDa APC Datasheet   Optical Properties: λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5     ATTO 390 Overview: High fluorescence yield Large Stokes-shift (89 nm) Good photostability Moderately hydrophilic Good solubility in polar solvents Coumarin derivate, uncharged Low molar mass: 343.42 g/mol  ATTO 390 Datasheet Optical Properties: λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm     ATTO 488 Overview: High fluorescence yield High photostability Very hydrophilic Excellent solubility in water Very little aggregation New dye with net charge of -1 Molar Mass: 804 g/mol  ATTO 488 Datasheet    Optical Properties: λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC    ATTO 565 Overview: High fluorescence yield High thermal and photostability Good solubility in polar solvents Excellent solubility in water Very little aggregation Rhodamine dye derivative Molar Mass: 611 g/mol ATTO 565 Datasheet   Optical Properties: λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC    ATTO 594 Overview: High fluorescence yield High photostability Very hydrophilic Excellent solubility in water Very little aggregation New dye with net charge of -1 Molar Mass: 1137 g/mol ATTO 594 Datasheet   Optical Properties: λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red®    ATTO 633 Overview: High fluorescence yield High thermal and photostability Moderately hydrophilic Good solubility in polar solvents Stable at pH 4 – 11 Cationic dye, perchlorate salt Molar Mass: 652.2 g/mol ATTO 633 Datasheet Optical Properties: λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5    ATTO 655 Overview: High fluorescence yield High thermal and photostability Excellent ozone resistance Quenched by electron donors Very hydrophilic Good solubility in polar solvents Zwitterionic dye Molar Mass: 634 g/mol ATTO 655 Datasheet Optical Properties: λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5    ATTO 680 Overview: High fluorescence yield Excellent thermal and photostability Quenched by electron donors Very hydrophilic Good solubility in polar solvents Zwitterionic dye Molar Mass: 631 g/mol ATTO 680 Datasheet   Optical Properties: λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5    ATTO 700 Overview: High fluorescence yield Excellent thermal and photostability Quenched by electron donors Very hydrophilic Good solubility in polar solvents Zwitterionic dye Molar Mass: 575 g/mol ATTO 700 Datasheet   Optical Properties: λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5     FITC (Fluorescein) Overview: Excellent fluorescence quantum yield High rate of photobleaching Good solubility in water Broad emission spectrum pH dependent spectra Molecular formula: C20H12O5 Molar mass: 332.3 g/mol FITC-Fluorescent-conjugate Optical Properties: λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC    PE/ATTO 594 PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. Overview: High fluorescence yield High photostability Very hydrophilic Excellent solubility in water Very little aggregation PE/ATTO 594 Datasheet Optical Properties: λex = 535 nm λem = 627 nm Laser = 488 to 561 nm    PerCP  Overview: Peridinin-Chlorophyll-Protein Complex Small phycobiliprotein Isolated from red algae Large stokes shift (195 nm) Molecular Weight: 35 kDa PerCP Datasheet   Optical Properties: λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm     R-PE (R-Phycoerythrin) Overview: Broad excitation spectrum High quantum yield Photostable Member of the phycobiliprotein family Isolated from red algae Excellent solubility in water Molecular Weight: 250 kDa R-PE Datasheet   Optical Properties: λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC   AP (Alkaline Phosphatase) Properties: Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation Catalyzes the conversion of: Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products Molecular weight: 140 kDa Applications: Western blot, immunohistochemistry, and ELISA AP Datasheet HRP (Horseradish peroxidase) Properties: Enzymatic activity is used to amplify weak signals and increase visibility of a target Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors Catalyzes the conversion of: Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL) Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products High turnover rate enables rapid generation of a strong signal 44 kDa glycoprotein Extinction coefficient: 100 (403 nm) Applications: Western blot, immunohistochemistry, and ELISA HRP Datasheet Biotin Properties: Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity Molar mass: 244.31 g/mol Formula: C10H16N2O3S Applications: Western blot, immunohistochemistry, and ELISA Biotin Datasheet Streptavidin Properties: Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity Molecular weight: 53 kDa Formula: C10H16N2O3S Applications: Western blot, immunohistochemistry, and ELISA Streptavidin Datasheet
Nature	Recombinant
Species	Human
Expression System	E. coli
Amino Acid Sequence	MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Purity	>90%

Storage Buffer	20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 0.5mM DTT
Storage Temperature	-20ºC
Shipping Temperature	Blue Ice or 4ºC
Purification	Affinity Purified
Specificity	~26 kDa
Cite This Product	Human Recombinant Rab5 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-121)
Certificate of Analysis	This product has been certified >90% pure using SDS-PAGE analysis.

Alternative Names	Rab 5A Protein, RAS associated protein RAB5A Protein, Ras related protein Rab 5 A Protein
Research Areas	Cancer, Heat Shock
Cellular Localization	Cell membrane, Early Endosome Membrane, Melanosome
Accession Number	BC001267
Gene ID	5868
Swiss Prot	P20339
Scientific Background	Rab5 is a 24kDa member of the Rab family of small guanosine triphosphatases (GTPases), Ras superfamily. Rab GTPases are central regulators of membrane trafficking in the eukaryotic cell. Their regulatory capacity depends on their ability to cycle between the GDP -bound inactive and GTP-bound active states. This conversion is regulated by GDP/GTP exchange factors (GEPs), GDP dissociation inhibitors (GDIs) and GTPase-activating proteins (GAPs) (1, 2). Activation of a Rab protein is coupled to its association with intracellular membranes, allowing it to recruit downstream effector proteins to the cytoplasmic surface of a subcellular compartment (3). Through these proteins, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion(1). Rab proteins contain conserved regions involved in guanine-nucleotide binding, and hyper variable COHO-terminal domains with a cysteine motif implicated in subcellular targeting. Post-translational modification of the cysteine motif with one or two geranyl groups is essential for the membrane association and correct intracellular localization of Rab proteins(3). Each Rab shows a characteristic subcellular distribution (4). In particular, Rab5 is ubiquitously expressed in human tissues. It localizes mainly to early endosomes, but is also present on the plasma membrane. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes (5). Among the proteins recruited by the GTP-bound active Rab5 are Rabaptin-5 and EEA1 (6). Anti-Rab5 may be used as an early endosome marker.
References	1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.