Anti-Myosin heavy chain Antibody
Anti-Myc Tag Antibody 5D6
Anti-Myc Tag Antibody
5D6__Mouse Anti-Myc Tag Monoclonal IgG1 Dinoprost (tromethamine salt)
Storage Buffer
PBS (without Mg2+ and Ca2+), 50% glycerol, pH 7.4, 150mM NaCl, 0.02% sodium azide
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Clonality
Monoclonal
Clone Number
5D6
Isotype
IgG1
Specificity
Detect C-Myc fusion proteins.
Cite This Product
Mouse Anti-Human myelocytomatosis tag Monoclonal, Clone 5D6 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SMC-255)
Certificate of Analysis
A 1:10000 dilution of SMC-255 was sufficient for detection of Myc Tag in 10 µg of Recombinant Protein by ECL immunoblot analysis using Goat Anti-Mouse IgG:HRP as the secondary antibody.
Alternative Names
avian myelocytomatosis viral oncogene homolog Antibody, c-Myc Antibody, MRTL Antibody, MYC Antibody, Myc Epitope Tag Antibody, oncogene c-Myc Antibody, proto-oncogene c-Myc Antibody
Scientific Background
Epitope tags are short peptide sequences that are easily recognized by tag-specific antibodies. Due to their small size, epitope tags do not affect the tagged protein’s biochemical properties. The Myc epitope tag is widely used to detect expression of recombinant proteins in bacteria, yeast, insect and mammalian cell systems.
References
1. Munro S. and Pelham H.R. (1984) EMBO J. 3: 3087-93.
Anti-mTOR Antibody (pSer2448)
Anti-mTOR Antibody (pSer2448)__Rabbit Anti-Human mTOR (pSer2448) Polyclonal CH5424803
Product Name
mTOR Antibody (pSer2448)
Description
Rabbit Anti-Human mTOR (pSer2448) Polyclonal
Species Reactivity
Human
Applications
,
WB
,
AM
Antibody Dilution
WB (1:250); optimal dilutions for assays should be determined by the user.
Host Species
Rabbit
Immunogen Species
Human
Immunogen
A phospho-specific peptide corresponding to residues surrounding Ser2448 of human mTOR (AA2445-2451)
Conjugates
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Storage Buffer
PBS pH7.4, 50% glycerol, 0.025% Thimerosal
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Peptide Affinity Purified
Clonality
Polyclonal
Specificity
Detects 288.892 kDa.
Cite This Product
Rabbit Anti-Human mTOR (pSer2448) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1034)
Certificate of Analysis
A 1:250 dilution of SPC-1034 was sufficient for detection of mTOR (pSer2448) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.
Alternative Names
FK506 binding protein 12 rapamycin associated protein 1 antibody, FK506 binding protein 12 rapamycin associated protein 2 antibody, FKBP rapamycin associated protein antibody, FKBP12 rapamycin complex associated protein antibody, FRAP antibody, FRAP1 antibody, FRAP2 antibody, Mammalian target of rapamycin antibody, Mechanistic target of rapamycin antibody, mTOR antibody, MTOR_HUMAN antibody, RAFT1 antibody, Rapamycin and FKBP12 target 1 antibody, Rapamycin target protein 1 antibody, Rapamycin target protein antibody, RAPT1 antibody, Serine/threonine-protein kinase mTOR antibody
Cellular Localization
Cytoplasm, Endoplasmic reticulum membrane, Golgi Apparatus Membrane, Lysosome
Accession Number
NP_004949
Gene ID
2475
Swiss Prot
P42345
Scientific Background
MTOR is a protein-serine/threonine kinase. It regulates various cellular pathways such as insulin signalling, eIF4e and p70S6 kinase activation for protein synthesis, HIFa, VEGF, cell proliferation, nutrient and hormone signals, ribosome biogenesis, regulation of cell cycle progrssion, angiogensis, cell polarity and cytokeleton reorganization. Dysregulation in signalling that leads to constant activation of mTOR lead to uncontrolled prolifertaion and cell cycle progression and oncogensis. Increased invasiveness has also be shown do be associated with mTOR activity. While it features a wide range of mutations, this might reflect the very large size of the protein rather than its identification as a tumour suppressor protein.
Rabbit Anti-Human mTOR (pSer2448) Polyclonal
WB
,
AM
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Anti-mTOR Antibody
Anti-mTOR Antibody__Rabbit Anti-Human mTOR Polyclonal Glesatinib (hydrochloride)
Product Name
mTOR Antibody
Description
Rabbit Anti-Human mTOR Polyclonal
Species Reactivity
Human
Applications
,
WB
,
AM
Antibody Dilution
WB (1:250); optimal dilutions for assays should be determined by the user.
Host Species
Rabbit
Immunogen Species
Human
Immunogen
Synthetic peptide of human mTOR (AA2492-2505)
Conjugates
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Storage Buffer
PBS pH7.4, 50% glycerol, 0.025% Thimerosal
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Peptide Affinity Purified
Clonality
Polyclonal
Specificity
Detects 288.892 kDa.
Cite This Product
Rabbit Anti-Human mTOR Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1176)
Certificate of Analysis
A 1:250 dilution of SPC-1176 was sufficient for detection of mTOR in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.
Alternative Names
FK506 binding protein 12 rapamycin associated protein 1 antibody, FK506 binding protein 12 rapamycin associated protein 2 antibody, FKBP rapamycin associated protein antibody, FKBP12 rapamycin complex associated protein antibody, FRAP antibody, FRAP1 antibody, FRAP2 antibody, Mammalian target of rapamycin antibody, Mechanistic target of rapamycin antibody, mTOR antibody, MTOR_HUMAN antibody, RAFT1 antibody, Rapamycin and FKBP12 target 1 antibody, Rapamycin target protein 1 antibody, Rapamycin target protein antibody, RAPT1 antibody, Serine/threonine-protein kinase mTOR antibody
Cellular Localization
Cytoplasm, Endoplasmic reticulum membrane, Golgi Apparatus Membrane, Lysosome
Accession Number
NP_004949
Gene ID
2475
Swiss Prot
P42345
Scientific Background
MTOR is a protein-serine/threonine kinase. It regulates various cellular pathways such as insulin signalling, eIF4e and p70S6 kinase activation for protein synthesis, HIFa, VEGF, cell proliferation, nutrient and hormone signals, ribosome biogenesis, regulation of cell cycle progrssion, angiogensis, cell polarity and cytokeleton reorganization. Dysregulation in signalling that leads to constant activation of mTOR lead to uncontrolled prolifertaion and cell cycle progression and oncogensis. Increased invasiveness has also be shown do be associated with mTOR activity. While it features a wide range of mutations, this might reflect the very large size of the protein rather than its identification as a tumour suppressor protein.
Rabbit Anti-Human mTOR Polyclonal
WB
,
AM
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Anti-MST3 Antibody (pThr190)
Anti-MST3 Antibody (pThr190)__Rabbit Anti-Human MST3 (pThr190) Polyclonal Selumetinib
Product Name
MST3 Antibody (pThr190)
Description
Rabbit Anti-Human MST3 (pThr190) Polyclonal
Species Reactivity
Human
Applications
,
WB
,
AM
Antibody Dilution
WB (1:250); optimal dilutions for assays should be determined by the user.
Host Species
Rabbit
Immunogen Species
Human
Immunogen
A phospho-specific peptide corresponding to residues surrounding Thr190 of human MST3 (AA187-193)
Conjugates
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Storage Buffer
PBS pH7.4, 50% glycerol, 0.025% Thimerosal
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Peptide Affinity Purified
Clonality
Polyclonal
Specificity
Detects 49.308 kDa.
Cite This Product
Rabbit Anti-Human MST3 (pThr190) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1033)
Certificate of Analysis
A 1:250 dilution of SPC-1033 was sufficient for detection of MST3 (pThr190) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.
Alternative Names
Mammalian STE20-like protein kinase 3 antibody, Mammalian sterile 20-like 3 antibody, MST-3 antibody, MST3/C antibody, MST3/N antibody, MST3B antibody, serine threonine kinase 24 antibody, STE20 homolog yeast antibody, STE20 like kinase MST3 antibody, STE20-like kinase MST3 antibody, Stk24 antibody, STK24_HUMAN antibody, STK3 antibody
Cellular Localization
Cytoplasm, Membrane, Nucleus
Accession Number
NP_003567
Gene ID
8428
Swiss Prot
Q9Y6E0
Rabbit Anti-Human MST3 (pThr190) Polyclonal
WB
,
AM
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Anti-MST3 Antibody (pThr184)
Anti-MST3 Antibody (pThr184)__Rabbit Anti-Human MST3 (pThr184) Polyclonal VE-823
Product Name
MST3 Antibody (pThr184)
Description
Rabbit Anti-Human MST3 (pThr184) Polyclonal
Species Reactivity
Human
Applications
,
WB
,
AM
Antibody Dilution
WB (1:250); optimal dilutions for assays should be determined by the user.
Host Species
Rabbit
Immunogen Species
Human
Immunogen
A phospho-specific peptide corresponding to residues surrounding Thr184 of human MST3 (AA181-187)
Conjugates
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Storage Buffer
PBS pH7.4, 50% glycerol, 0.025% Thimerosal
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Peptide Affinity Purified
Clonality
Polyclonal
Specificity
Detects 49.308 kDa.
Cite This Product
Rabbit Anti-Human MST3 (pThr184) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1032)
Certificate of Analysis
A 1:250 dilution of SPC-1032 was sufficient for detection of MST3 (pThr184) in 10 µg of HeLa cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.
Alternative Names
Mammalian STE20-like protein kinase 3 antibody, Mammalian sterile 20-like 3 antibody, MST-3 antibody, MST3/C antibody, MST3/N antibody, MST3B antibody, serine threonine kinase 24 antibody, STE20 homolog yeast antibody, STE20 like kinase MST3 antibody, STE20-like kinase MST3 antibody, Stk24 antibody, STK24_HUMAN antibody, STK3 antibody
Cellular Localization
Cytoplasm, Membrane, Nucleus
Accession Number
NP_003567
Gene ID
8428
Swiss Prot
Q9Y6E0
Rabbit Anti-Human MST3 (pThr184) Polyclonal
WB
,
AM
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
MS 275
MS 275__HDAC inhibitor NVP-AUY923
Product Name
MS 275
Description
HDAC inhibitor
Purity
>98.5
CAS No.
209783-80-2
Molecular Formula
C21H20N4O3
Molecular Weight
376.41
Storage Temperature
-20ºC
Shipping Temperature
Shipped Ambient
Product Type
Inhibitor
Solubility
Soluble in DMSO or methanol.
Source
Synthetic
Appearance
Off white solid
SMILES
C2=C(C(=O)NC1=C(N)C=CC=C1)C=CC(=C2)CNC(OCC3=CN=CC=C3)=O
InChI
InChI=1S/C21H20N4O3/c22-18-5-1-2-6-19(18)25-20(26)17-9-7-15(8-10-17)13-24-21(27)28-14-16-4-3-11-23-12-16/h1-12H,13-14,22H2,(H,24,27)(H,25,26)
InChIKey
INVTYAOGFAGBOE-UHFFFAOYSA-N
Safety Phrases
Classification: D1B Toxic Material Causing Immediate and SeriousToxic Effects, Toxic by ingestion, D2A Very Toxic Material Causing Other Toxic Effects, Teratogen, D2B Toxic Material Causing Other Toxic Effects, Reproductive hazard, Moderate skin irritant, Moderate eye irritant
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.
Hazard statements:
H301 Toxic if swallowed.
H315 Causes skin irritation.
H319 Causes serious eye irritation.
H335 May cause respiratory irritation.
H360 May damage fertility or the unborn child.
Precautionary statements:
P201 Obtain special instructions before use.
P261 Avoid breathing dust/ fume/ gas/ mist/ vapours/ spray.
P301 + P310 IF SWALLOWED: Immediately call a POISON CENTER or doctor/ physician.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
P308 + P313 IF exposed or concerned: Get medical advice/ attention.
Cite This Product
MS 275 (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-416)
Alternative Names
3-pyridinylmethyl 4-(2-aminophenyl)aminocarbonylphenylmethylcarbamate, N-(2-Aminophenyl)-4-N-(pyridine-3ylmethoxycarbonyl)aminomethylbenzamide
Research Areas
Cancer, Cell Signaling, Epigenetics
PubChem ID
4261
Scientific Background
MS 275, also referred to as Entinostat, is a benzamide histone deacetylase inhibitor. It preferentially inhibits HDAC1 and HDAC3. It is currently undergoing several clinical trials for the treatment of Hodgkin's lymphoma, advanced breast cancer, and for metastatic lung cancer.
References
1. Camphausen K., Burgan W., Cerra M., Oswald K.A., Trepel J.B., Lee M.J., et al. (2004) Cancer Res. 316-21.
HDAC inhibitor
Safety Phrases:
S22 – Do not breathe dust.
S24/25 – Avoid contact with skin and eyes.
S36/37/39 – Wear suitable protective clothing, gloves and eye/face protection.
Hazard statements:
H301 Toxic if swallowed.
H315 Causes skin irritation.
H319 Causes serious eye irritation.
H335 May cause respiratory irritation.
H360 May damage fertility or the unborn child.
Precautionary statements:
P201 Obtain special instructions before use.
P261 Avoid breathing dust/ fume/ gas/ mist/ vapours/ spray.
P301 + P310 IF SWALLOWED: Immediately call a POISON CENTER or doctor/ physician.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
P308 + P313 IF exposed or concerned: Get medical advice/ attention.
Montelukast sodium
Montelukast sodium__Leukotriene CysLT1 antagonist SJG-137
Product Name
Montelukast sodium
Description
Leukotriene CysLT1 antagonist
Purity
>98% (HPLC); NMR (conforms)
CAS No.
151767-02-1
Molecular Formula
C35H35ClNO3S • Na
Molecular Weight
608.2
Storage Temperature
-20ºC
Shipping Temperature
Shipped Ambient
Product Type
Antagonist
Solubility
Soluble in DMSO (50 mg/ml), or water (30 mg/ml), or ethanol (60 mg/ml)
Source
Synthetic
Appearance
Powder
SMILES
CC(C)(O)C(C=CC=C1)=C1CCemail protected(SCC2(CC2)CC(O-)=O)C3=CC(/C=C/C4=NC5=CC(Cl)=CC=C5C=C4)=CC=C3.Na+
InChI
1S/C35H36ClNO3S.Na/c1-34(2,40)30-9-4-3-7-25(30)13-17-32(41-23-35(18-19-35)22-33(38)39)27-8-5-6-24(20-27)10-15-29-16-12-26-11-14-28(36)21-31(26)37-29;/h3-12,14-16,20-21,32,40H,13,17-19,22-23H2,1-2H3,(
InChIKey
LBFBRXGCXUHRJY-YBGTYPRZSA-M
Safety Phrases
Classification:
D2A Very Toxic Material Causing Other Toxic Effects – Reproductive hazard
E Corrosive Material – Corrosive to skin
Hazard statement(s):
H318 Causes serious eye damage.
H361fd Suspected of damaging fertility. Suspected of damaging the unborn child.
Precautionary statement(s):
P280 Wear protective gloves/ eye protection/ face protection.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
Cite This Product
Montelukast sodium (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SIH-538)
Alternative Names
1-(1R)-1-3-(1E)-2-(7-chloro-2-quinolinyl)ethenylphenyl-3-2-(1-hydroxy-1-methylethyl)phenylpropylthio-methyl-cyclopropaneacetic acid, monosodium salt, Montelukast sodium, Montelukast monosodium salt, MK-0476, MK-476, KS-1087
Research Areas
Immunology, Innate Immunity, Macrophage
PubChem ID
23663996
Scientific Background
Montelukast is a cysteinyl leukotriene receptor 1 (CysLT1) antagonist. It blocks pentylenetetrazole-induced seizures, blood brain barrier disruption and leukocyte migration in mice.
Leukotriene CysLT1 antagonist
D2A Very Toxic Material Causing Other Toxic Effects – Reproductive hazard
E Corrosive Material – Corrosive to skin
Hazard statement(s):
H318 Causes serious eye damage.
H361fd Suspected of damaging fertility. Suspected of damaging the unborn child.
Precautionary statement(s):
P280 Wear protective gloves/ eye protection/ face protection.
P305 + P351 + P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
Anti-MOK Antibody (pThr159+pTyr161)
Anti-MOK Antibody (pThr159+pTyr161)__Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal Dinaciclib
Product Name
MOK Antibody (pThr159+pTyr161)
Description
Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal
Species Reactivity
Human
Applications
,
WB
,
AM
Antibody Dilution
WB (1:250); optimal dilutions for assays should be determined by the user.
Host Species
Rabbit
Immunogen Species
Human
Immunogen
A phospho-specific peptide corresponding to residues surrounding Thr159 and Tyr161 of human MOK (AA156-163)
Conjugates
Alkaline Phosphatase, APC, ATTO 390, ATTO 488, ATTO 565, ATTO 594, ATTO 633, ATTO 655, ATTO 680, ATTO 700, Biotin, FITC, HRP, PE/ATTO 594, PerCP, RPE, Streptavidin, Unconjugated
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Storage Buffer
PBS pH7.4, 50% glycerol, 0.025% Thimerosal
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Peptide Affinity Purified
Clonality
Polyclonal
Specificity
Detects 48.014 kDa.
Cite This Product
Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPC-1030)
Certificate of Analysis
A 1:250 dilution of SPC-1030 was sufficient for detection of MOK (pThr159+pTyr161) in 10 µg of 293T cell lysate by ECL immunoblot analysis using goat anti-rabbit IgG:HRP as the secondary antibody.
Alternative Names
MAPK/MAK/MRK overlapping kinase antibody, MOK antibody, MOK protein kinase antibody, MOK_HUMAN antibody, RAGE 1 antibody, RAGE antibody, Renal cell carcinoma antigen (MOK protein kinase) antibody, Renal tumor antigen 1 antibody, STK30 antibody
Cellular Localization
Cytoplasm
Accession Number
NP_055041
Gene ID
5891
Swiss Prot
Q9UQ07
Rabbit Anti-Human MOK (pThr159+pTyr161) Polyclonal
WB
,
AM
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Mn SOD Protein
Mn SOD Protein__Human Recombinant Mn SOD Protein ML RR-S3 CDA
Product Name
Mn SOD Protein
Description
Human Recombinant Mn SOD Protein
Applications
,
WB
,
SDS-PAGE
Concentration
Lot/batch specific. See included datasheet.
Conjugates
His tag
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa

Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 390
Overview:
- High fluorescence yield
- Large Stokes-shift (89 nm)
- Good photostability
- Moderately hydrophilic
- Good solubility in polar solvents
- Coumarin derivate, uncharged
- Low molar mass: 343.42 g/mol
ATTO 390 Datasheet

Optical Properties:
λex = 390 nm
λem = 479 nm
εmax = 2.4×104
Φf = 0.90
τfl = 5.0 ns
Brightness = 21.6
Laser = 365 or 405 nm
ATTO 488
Overview:

Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:

Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:

Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:

Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:

Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:

Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol

Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:

Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:

Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:

Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:

Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Nature
Recombinant
Species
Human
Expression System
E. coli
Amino Acid Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Purity
>90%
Storage Buffer
50mM Tris/HCl pH7.7, 0.15M NaCl, 5mM DTT, 10% glycerol
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Affinity Purified
Specificity
~25 kDa
Cite This Product
Human Recombinant Mn SOD Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-131)
Certificate of Analysis
This product has been certified >90% pure using SDS-PAGE analysis.
Alternative Names
Manganese SOD Protein, IPO B Protein, Mn SOD Protein, SOD2 Protein, Superoxide Dismutase (Mn) mitochondrial protein
Research Areas
Cancer, Cell Signaling, Chaperones, Oxidative Stress, Trafficking
Cellular Localization
Mitochondrion Matrix
Accession Number
BC070913
Gene ID
24787
Swiss Prot
P04179
Scientific Background
Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).
References
1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102.
2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180.
3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6.
4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925.
5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385.
6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180.
7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495.
8. Wispe J.R., et al. (1989) BBA. 994: 30-36.
Human Recombinant Mn SOD Protein
WB
,
SDS-PAGE
APC (Allophycocyanin) | ||
Overview:
|
![]() |
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 390 | ||
Overview:
ATTO 390 Datasheet |
![]() |
Optical Properties:
λex = 390 nm λem = 479 nm εmax = 2.4×104 Φf = 0.90 τfl = 5.0 ns Brightness = 21.6 Laser = 365 or 405 nm |
ATTO 488 | ||
Overview: | ![]() |
Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | ![]() |
Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | ![]() |
Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | ![]() |
Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | ![]() |
Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | ![]() |
Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
![]() |
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | ![]() |
Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | ![]() |
Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | ![]() |
Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | ![]() |
Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
Streptavidin
Properties:
- Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
- Molecular weight: 53 kDa
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180.
3. Furukawa Y., and O’Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6.
4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925.
5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385.
6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180.
7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495.
8. Wispe J.R., et al. (1989) BBA. 994: 30-36.