AHA1 Protein__Yeast Recombinant AHA1 Protein MLN4924
Product Name
AHA1 Protein
Description
Yeast Recombinant AHA1 Protein
Applications
,
WB
,
SDS-PAGE
,
Functional Assay
Concentration
Lot/batch specific. See included datasheet.
Conjugates
His tag
APC (Allophycocyanin)
Overview:
- High quantum yield
- Large phycobiliprotein
- 6 chromophores per molecule
- Isolated from red algae
- Molecular Weight: 105 kDa
Optical Properties:
λex = 650 nm
λem = 660 nm
εmax = 7.0×105
Φf = 0.68
Brightness = 476
Laser = 594 or 633 nm
Filter set = Cy®5
ATTO 488
Overview:
Optical Properties:
λex = 501 nm
λem = 523 nm
εmax = 9.0×104
Φf = 0.80
τfl = 4.1 ns
Brightness = 72
Laser = 488 nm
Filter set = FITC
ATTO 565
Overview:
Optical Properties:
λex = 563 nm
λem = 592 nm
εmax = 1.2×105
Φf = 0.9
τfl = 3.4 n
Brightness = 10
Laser = 532 nm
Filter set = TRITC
ATTO 594
Overview:
Optical Properties:
λex = 601 nm
λem = 627 nm
εmax = 1.2×105
Φf = 0.85
τfl = 3.5 ns
Brightness = 102
Laser = 594 nm
Filter set = Texas Red®
ATTO 633
Overview:
Optical Properties:
λex = 629 nm
λem = 657 nm
εmax = 1.3×105
Φf = 0.64
τfl = 3.2 ns
Brightness = 83.2
Laser = 633 nm
Filter set = Cy®5
ATTO 655
Overview:
Optical Properties:
λex = 663 nm
λem = 684 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.8 ns
Brightness = 37.5
Laser = 633 – 647 nm
Filter set = Cy®5
ATTO 680
Overview:
Optical Properties:
λex = 680 nm
λem = 700 nm
εmax = 1.25×105
Φf = 0.30
τfl = 1.7 ns
Brightness = 37.5
Laser = 633 – 676 nm
Filter set = Cy®5.5
ATTO 700
Overview:
- High fluorescence yield
- Excellent thermal and photostability
- Quenched by electron donors
- Very hydrophilic
- Good solubility in polar solvents
- Zwitterionic dye
- Molar Mass: 575 g/mol
Optical Properties:
λex = 700 nm
λem = 719 nm
εmax = 1.25×105
Φf = 0.25
τfl = 1.6 ns
Brightness = 31.3
Laser = 676 nm
Filter set = Cy®5.5
FITC (Fluorescein)
Overview:
Optical Properties:
λex = 494 nm
λem = 520 nm
εmax = 7.3×104
Φf = 0.92
τfl = 5.0 ns
Brightness = 67.2
Laser = 488 nm
Filter set = FITC
PE/ATTO 594
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.
Overview:
Optical Properties:
λex = 535 nm
λem = 627 nm
Laser = 488 to 561 nm
PerCP
Overview:
Optical Properties:
λex = 482 nm
λem = 677 nm
εmax = 1.96 x 106
Laser = 488 nm
R-PE (R-Phycoerythrin)
Overview:
Optical Properties:
λex = 565 nm
λem = 575 nm
εmax = 2.0×106
Φf = 0.84
Brightness = 1.68 x 103
Laser = 488 to 561 nm
Filter set = TRITC
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
HRP (Horseradish peroxidase)
Properties:
- Enzymatic activity is used to amplify weak signals and increase visibility of a target
- Readily combines with hydrogen peroxide (H2O2) to form HRP-H2O2 complex which can oxidize various hydrogen donors
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
- High turnover rate enables rapid generation of a strong signal
- 44 kDa glycoprotein
- Extinction coefficient: 100 (403 nm)
- Applications: Western blot, immunohistochemistry, and ELISA
Biotin
Properties:
- Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity
- Molar mass: 244.31 g/mol
- Formula: C10H16N2O3S
- Applications: Western blot, immunohistochemistry, and ELISA
Expression System
E. coli
Amino Acid Sequence
MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL
Purity
>90%
Storage Buffer
12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol
Storage Temperature
-20ºC
Shipping Temperature
Blue Ice or 4ºC
Purification
Affinity Purified
Specificity
~405 kDa
Cite This Product
Yeast Recombinant AHA1 Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-314)
Certificate of Analysis
This product has been certified >90% pure using SDS – PAGE analysis.
References PubMed ID::http://www.ncbi.nlm.nih.gov/pubmed/19112222
Alternative Names
Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein
Research Areas
Cancer, Heat Shock, Cell Signaling, Chaperones, Trafficking
Cellular Localization
Cytoplasm
Accession Number
NM_001180522.1
Gene ID
851800
Swiss Prot
Q12449
Scientific Background
Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).
References
1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.
Yeast Recombinant AHA1 Protein
WB
,
SDS-PAGE
,
Functional Assay
APC (Allophycocyanin) | ||
Overview:
|
Optical Properties:
λex = 650 nm λem = 660 nm εmax = 7.0×105 Φf = 0.68 Brightness = 476 Laser = 594 or 633 nm Filter set = Cy®5 |
ATTO 488 | ||
Overview: | Optical Properties:
λex = 501 nm λem = 523 nm εmax = 9.0×104 Φf = 0.80 τfl = 4.1 ns Brightness = 72 Laser = 488 nm Filter set = FITC |
ATTO 565 | ||
Overview: | Optical Properties:
λex = 563 nm λem = 592 nm εmax = 1.2×105 Φf = 0.9 τfl = 3.4 n Brightness = 10 Laser = 532 nm Filter set = TRITC |
ATTO 594 | ||
Overview: | Optical Properties:
λex = 601 nm λem = 627 nm εmax = 1.2×105 Φf = 0.85 τfl = 3.5 ns Brightness = 102 Laser = 594 nm Filter set = Texas Red® |
ATTO 633 | ||
Overview: | Optical Properties:
λex = 629 nm λem = 657 nm εmax = 1.3×105 Φf = 0.64 τfl = 3.2 ns Brightness = 83.2 Laser = 633 nm Filter set = Cy®5 |
ATTO 655 | ||
Overview: | Optical Properties:
λex = 663 nm λem = 684 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.8 ns Brightness = 37.5 Laser = 633 – 647 nm Filter set = Cy®5 |
ATTO 680 | ||
Overview: | Optical Properties:
λex = 680 nm λem = 700 nm εmax = 1.25×105 Φf = 0.30 τfl = 1.7 ns Brightness = 37.5 Laser = 633 – 676 nm Filter set = Cy®5.5 |
ATTO 700 | ||
Overview:
|
Optical Properties:
λex = 700 nm λem = 719 nm εmax = 1.25×105 Φf = 0.25 τfl = 1.6 ns Brightness = 31.3 Laser = 676 nm Filter set = Cy®5.5 |
FITC (Fluorescein) | ||
Overview: | Optical Properties:
λex = 494 nm λem = 520 nm εmax = 7.3×104 Φf = 0.92 τfl = 5.0 ns Brightness = 67.2 Laser = 488 nm Filter set = FITC |
PE/ATTO 594 | ||
PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm. | ||
Overview: | Optical Properties:
λex = 535 nm λem = 627 nm Laser = 488 to 561 nm |
PerCP | ||
Overview: | Optical Properties:
λex = 482 nm λem = 677 nm εmax = 1.96 x 106 Laser = 488 nm |
R-PE (R-Phycoerythrin) | ||
Overview: | Optical Properties:
λex = 565 nm λem = 575 nm εmax = 2.0×106 Φf = 0.84 Brightness = 1.68 x 103 Laser = 488 to 561 nm Filter set = TRITC |
AP (Alkaline Phosphatase)
Properties:
- Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
- Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
- Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
- Molecular weight: 140 kDa
- Applications: Western blot, immunohistochemistry, and ELISA
Properties:
Properties:HRP (Horseradish peroxidase)
Biotin
2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.
3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.
4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.