Name : GPR15 (Human) Recombinant Protein (Q01) Biological Activity : Human GPR15 partial ORF (NP_005281.1, 261 a.a. – 360 a.a.) recombinant protein with GST tag at N-terminal. Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_005281.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2838 Amino Acid Sequence …
Author Archives: Tankyrase- tankyrase
IL-1 beta/IL-1F2 Protein
Name : IL-1 beta/IL-1F2 ProteinDescription : Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family. IL1 is a pleiotropic cytokine. It is involved in the inflammatory response, cell growth, and tissue repair in the cortex. The IL1 superfamily consists of three members, IL1A (IL1 alpha), …
GPM6B (Human) Recombinant Protein (P01)
Name : GPM6B (Human) Recombinant Protein (P01) Biological Activity : Human GPM6B full-length ORF ( NP_001001996.1, 1 a.a. – 305 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_001001996.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2824 …
IL-17RA Protein
Name : IL-17RA ProteinDescription : Interleukin-17 receptor (IL-17R), also known as Interleukin-17 receptor A (IL-17RA) and CD217 antigen (CD217), is a cytokine receptor that binds interleukin 17. IL-17R/IL-17RA (CD217) is a proinflammatory cytokine secreted by activated T-lymphocytes. It is a potent inducer of the maturation of CD34-positive hematopoietic precursors into neutrophils. IL-17R/IL-17RA (CD217) is a …
GABRA1 (Human) Recombinant Protein (P01)
Name : GABRA1 (Human) Recombinant Protein (P01) Biological Activity : Human GABRA1 full-length ORF ( NP_000797.2, 1 a.a. – 456 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_000797.2 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2554 …
IL-1R1 Protein
Name : IL-1R1 ProteinDescription : Interleukin 1 receptor, type I (IL-1R1) also known as CD121a (Cluster of Differentiation 121a), is an interleukin receptor. IL-1R1/CD121a is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein is a receptor for interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I (IL1R1/IL1RA). …
CCR2 (Human) Recombinant Protein
Name : CCR2 (Human) Recombinant Protein Biological Activity : Human CCR2 (P41597-2, Met1-Leu360) partial recombinant protein expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro Tag : Result of bioactivity analysis Protein Accession No. : P41597-2 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=729230 Amino Acid Sequence : Met1-Ala374 Molecular Weight …
NCR3 (Human) Recombinant Protein
Name : NCR3 (Human) Recombinant Protein Biological Activity : Human NCR3 (AAH52582, Leu19-Thr138) partial recombinant protein with hFc tag at C-Terminus expressed in HEK293 cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro Tag : Result of bioactivity analysis Protein Accession No. : AAH52582 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=259197 Amino Acid Sequence : Leu19-Thr138 Molecular …
CDKN3 (Human) Recombinant Protein
Name : CDKN3 (Human) Recombinant Protein Biological Activity : Human CDKN3 (Q16667, 1 a.a. – 212 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Protein Accession No. : Q16667 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1033 Amino Acid Sequence : MGSSHHHHHHSSGLVPRGSHMKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR Molecular Weight : 25.9 Storage and …
CDC26 (Human) Recombinant Protein
Name : CDC26 (Human) Recombinant Protein Biological Activity : Human CDC26 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Protein Accession No. : Q8NHZ8 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=246184 Amino Acid Sequence : MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF Molecular Weight : 11.9 Storage and Stability : Store at 4°C for …