Name : ALB (Human) Recombinant Protein (P01) Biological Activity : Human ALB full-length ORF ( AAH34023, 19 a.a. – 609 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : AAH34023 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=213 …
Category Archives: Uncategorized
Human HLA-A*02:01&B2M&MAGE-A4 (GVYDGREHTV) Tetramer Protein 3423
Product Name : Human HLA-A*02:01&B2M&MAGE-A4 (GVYDGREHTV) Tetramer Protein 3423express system : HEK293Product tag : C-His-AviPurity: > 95% as determined by Tris-Bis PAGE;> 95% as determined by HPLCBackground: Melanoma-associated antigen 4 is a protein that in humans is encoded by the MAGEA4 gene.The MAGE- A4 antigen is among the most commonly expressed cancer testis antigens. The …
Continue reading “Human HLA-A*02:01&B2M&MAGE-A4 (GVYDGREHTV) Tetramer Protein 3423”
Human LIF R / CD118 Protein, Fc Tag
Name : Human LIF R / CD118 Protein, Fc Tag Background : Leukemia inhibitory factor receptor is also known as LIFR; CD118; FLJ98106; FLJ99923; LIF-R; SJS2; STWS; SWS, is the receptor for leukemia inhibitory factor (LIF). The leukemia inhibitory factor is a polyfunctional cytokine that affects the differentiation, survival, and proliferation of a wide variety …
C4b (Mouse) Recombinant Protein
Name : C4b (Mouse) Recombinant Protein Biological Activity : Mouse C4b partial ORF (NP_033910.2, 20 a.a. – 119 a.a.) recombinant protein with GST-tag at N-terminal. Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_033910.2 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=12268 Amino Acid Sequence : KPRLLLFSPSVVNLGTPLSVGVQLLDAPPGQEVKGSVFLRNPKGGSCSPKKDFKLSSGDDFVLLSLEVPLEDVRSCGLFDLRRAPHIQLVAQSPWLRNTA …
Biotinylated Human CD40 / TNFRSF5 Protein, Avitag™,His Tag (MALS verified)
Name : Biotinylated Human CD40 / TNFRSF5 Protein, Avitag™,His Tag (MALS verified) Background : CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including …
Continue reading “Biotinylated Human CD40 / TNFRSF5 Protein, Avitag™,His Tag (MALS verified)”
IL4 (Human) Recombinant Protein
Name : IL4 (Human) Recombinant Protein Biological Activity : Human IL4 (P05112, His 25 – Ser 153) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins Tag : Protein Accession No. : P05112 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3565 Amino Acid Sequence : Molecular Weight : 15 Storage and Stability : Store at -20°C …
BOLA2B (Human) Recombinant Protein (P01)
Name : BOLA2B (Human) Recombinant Protein (P01) Biological Activity : Human BOLA2B full-length ORF ( AAI53145.1, 1 a.a. – 152 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : AAI53145.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=654483 …
VMAC (Human) Recombinant Protein (P01)
Name : VMAC (Human) Recombinant Protein (P01) Biological Activity : Human VMAC full-length ORF (BAG54017.1, 1 a.a. – 169 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : BAG54017.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=400673 Amino …
LEKR1 (Human) Recombinant Protein (P01)
Name : LEKR1 (Human) Recombinant Protein (P01) Biological Activity : Human LEKR1 full-length ORF (BAD18618.1, 1 a.a. – 388 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : BAD18618.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=389170 Amino …
NMNAT3 (Human) Recombinant Protein (P01)
Name : NMNAT3 (Human) Recombinant Protein (P01) Biological Activity : Human NMNAT3 full-length ORF ( NP_835471.1, 1 a.a. – 215 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength Tag : Best use within three months from the date of receipt of this protein. Protein Accession No. : NP_835471.1 Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=349565 …