Tankyrase-tankyrase.com

Product Name :
D-tyrosyl-tRNA deacylase 1

Target gene :
DTD1

verified_species_reactivity :
Human

interspecies_information :
94%, ENSMUSG00000027430, species_id: MOUSE, 96%, ENSRNOG00000008746, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000125821

Entrez :
92675

UniProt :
Q8TEA8

Dilution:
1:50 – 1:200

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
517-89-5 SMILES 184475-35-2 supplier PMID:30726026 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
SNX4 Monoclonal Antibody (4H8)

Species Reactivity:
Human

Host/Isotype :
Mouse / IgG2a, kappa

Class:
Monoclonal

Type :
Antibody

Clone:
4H8

Conjugate :
Unconjugated

Form:
Liquid

Concentration :

Purification :
Protein A

Storage buffer:
PBS, pH 7.4

Contains :
no preservative

Storage conditions:
-20° C, Avoid Freeze/Thaw Cycles

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
KLHL22 Antibody custom synthesis Cytokeratin 8/18 Antibody web PMID:35175494 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
B-Raf proto-oncogene, serine/threonine kinase

Target gene :
BRAF

verified_species_reactivity :
Human

interspecies_information :
93%, ENSMUSG00000002413, species_id: MOUSE, 92%, ENSRNOG00000010957, species_id: RAT

clonality :
Monoclonal

isotype :
IgG1

host :
Mouse

buffer :
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Protein A purified

antigen_sequence :

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000157764

Entrez :
673

UniProt :
P15056

Dilution:
1:200 – 1:500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
1194506-26-7 Description 39011-90-0 custom synthesis PMID:20301336 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
distal-less homeobox 6

Target gene :
DLX6

verified_species_reactivity :
Human

interspecies_information :
99%, ENSMUSG00000029754, species_id: MOUSE, 99%, ENSRNOG00000010822, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
ALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000006377

Entrez :
1750

UniProt :
P56179

Dilution:
1:200 – 1:500

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
1809249-37-3 IUPAC Name 33507-63-0 medchemexpress PMID:30964851 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
SMS Polyclonal Antibody

Species Reactivity:
Human, Mouse, Rat

Host/Isotype :
Rabbit / IgG

Class:
Polyclonal

Type :
Antibody

Clone:

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
0.33 mg/mL

Purification :
Antigen affinity chromatography

Storage buffer:
0.1M tris glycine, pH 7, with 20% glycerol

Contains :
0.01% thimerosal

Storage conditions:
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

RRID:
AB_2552191

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Pergolide supplier Cefoperazone manufacturer PMID:34664399 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Name :
PPHLN1 (Human) Recombinant Protein (Q01)

Biological Activity :
Human PPHLN1 partial ORF ( NP_958846.1, 168 a.a. – 258 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_958846.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51535

Amino Acid Sequence :
KVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV

Molecular Weight :
35.75

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (83); Rat (81)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，

Gene Name :
PPHLN1

Gene Alias :
HSPC206, HSPC232, MGC48786

Gene Description :
periphilin 1

Gene Summary :
The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Other Designations :
gastric cancer antigen Ga50

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ATG5 Proteinweb
Glypican-3/GPC3 Proteinmedchemexpress
Popular categories:
MDL-1/CLEC5A
CD33

Product Name :
DENN/MADD domain containing 4A

Target gene :
DENND4A

verified_species_reactivity :
Human

interspecies_information :
84%, ENSMUSG00000053641, species_id: MOUSE, 82%, ENSRNOG00000011739, species_id: RAT

clonality :
Polyclonal

isotype :
IgG

host :
Rabbit

buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Affinity purified using the PrEST antigen as affinity ligand

antigen_sequence :
LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000174485

Entrez :
10260

UniProt :
Q7Z401

Dilution:
1:500 – 1:1000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
520-18-3 supplier 138977-28-3 site PMID:29083573 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
SLUG Polyclonal Antibody

Species Reactivity:
Human, Mouse, Rat

Host/Isotype :
Rabbit / IgG

Class:
Polyclonal

Type :
Antibody

Clone:

Conjugate :
Unconjugated

Form:
Liquid

Concentration :
1 mg/mL

Purification :
Protein A

Storage buffer:
PBS with 50% glycerol, 1% BSA

Contains :
0.09% sodium azide

Storage conditions:
-20°C

RRID:

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
CD43 Antibody Formula GATA-4 Antibody Purity & Documentation PMID:35221866 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
Anetumab-MMAE Biosimilar

Host species :

Species reactivity :
Human

Form:
Liquid

Storage buffer :

Concentration:
1 mg/ml

Purity :
>90% by SEC.

Clonality:
Monoclonal

Applications :
Research Grade Biosimilar

Target :
Mesothelin

Purification:

Endotoxin level.:
Please contact with the lab for this information.

Expression system :

Accession :

Stability and Storage:
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.Store at +4°C short term (1-2 weeks).Store at -20 °C 12 months. Store at -80°C long term.

Alternative Names:

Note:
For research use only. Not suitable for clinical or therapeutic use.

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Ferritin heavy chain/FTH1 Protein, Human custom synthesis FGF-8b Protein, Human/Mouse web PMID:35135428 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Product Name :
B-cell cll/lymphoma 11b

Target gene :
BCL11B

verified_species_reactivity :
Human

interspecies_information :
100%, ENSRNOG00000005776, species_id: RAT, 100%, ENSMUSG00000048251, species_id: MOUSE

clonality :
Monoclonal

isotype :
IgG1

host :
Mouse

buffer :
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

purification_method :
Protein A purified

antigen_sequence :

references :
Characterization data on the Human Protein Atlas”, This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies

shipping:
Normally shipped at ambient temperature

storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Ensembl :
ENSG00000127152

Entrez :
64919

UniProt :
Q9C0K0

Dilution:
1:500 – 1:1000

Retrieval method :
HIER pH6

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
55134-13-9 medchemexpress 56092-82-1 Molecular Weight PMID:30422518 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com